Loading...
Statistics
Advertisement

umija
www.umija.de/
umija

Umija.de

Domain is redirected to: Umija.org
Advertisement
Conversion Technology Metas Server
Umija.de is hosted in Germany / Nürnberg . Umija.de uses HTTPS protocol. Number of used technologies: 12. First technologies: CSS, Html, Javascript, Number of used javascripts: 34. First javascripts: Overlib.js, Raphael-min.js, G.raphael-min.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.15 (CentOS).

Technologies in use by Umija.de

Technology

Number of occurences: 12
  • CSS
  • Html
  • Javascript
  • jQuery
  • jQuery Bgiframe
  • jQuery Colorbox
  • jQuery Cookie
  • jQuery Hover Intent
  • jQuery Validate
  • jQuery UI
  • Php
  • SuperFish

Advertisement

Javascripts

Number of occurences: 34
  • overlib.js
  • raphael-min.js
  • g.raphael-min.js
  • g.pie-min.js
  • g.line-min.js
  • g.dot-min.js
  • g.bar-min.js
  • tiki-js.js
  • swfobject.js
  • jquery.js
  • tiki-jquery.js
  • autosave.js
  • jquery-ui.js
  • jquery.hoverIntent.js
  • jquery.bgiframe.min.js
  • jquery.cluetip.js
  • jquery.ajaxQueue.js
  • jquery.autocomplete.js
  • superfish.js
  • supersubs.js
  • jquery.sheet.js
  • jquery.sheet.advancedfn.js
  • jquery.json-2.2.js
  • mbMenu.min.js
  • jquery.scrollTo-min.js
  • jquery.colorbox.js
  • jquery.validate.js
  • jquery.cookie.js
  • jquery.treeTable.js
  • tiki-js-sorttable.js
  • jquery.async.js
  • language.js

Server Type

  • Apache/2.2.15 (CentOS)

Powered by

  • PHP/5.3.29

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Umija.de

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.monoceres.uberspace.de
    • subject:
      • OU: Domain Control Validated
      • CN: *.monoceres.uberspace.de
    • hash: e8becf9e
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: AlphaSSL CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492348208199159124536060179409507851268108
    • validFrom: 160328093315Z
    • validTo: 190511114720Z
    • validFrom_time_t: 1459157595
    • validTo_time_t: 1557575240
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 1.3.6.1.4.1.4146.1.10.10 CPS: https://www.globalsign.com/repository/ Policy: 2.23.140.1.2.1
      • subjectAltName: DNS:*.monoceres.uberspace.de, DNS:monoceres.uberspace.de
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl2.alphassl.com/gs/gsalphasha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure2.alphassl.com/cacert/gsalphasha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsalphasha2g2
      • subjectKeyIdentifier: 4A:41:0D:36:3E:3C:F0:DD:8D:99:E7:60:FB:AA:65:0B:F7:AF:7F:08
      • authorityKeyIdentifier: keyid:F5:CD:D5:3C:08:50:F9:6A:4F:3A:B7:97:DA:56:83:E6:69:D2:68:F7

Meta - Umija.de

Number of occurences: 5
  • Name:
    Content: text/html; charset=utf-8
  • Name: description
    Content: umija
  • Name: geo.region
    Content: DE
  • Name: revisit-after
    Content: 2
  • Name: google-site-verification
    Content: bi_e3LiPO0OYFGpobaBd46tOrRtQWHCT4KkDSZNefGM

Server / Hosting

  • IP: 78.46.0.150
  • Latitude: 49.45
  • Longitude: 11.07
  • Country: Germany
  • City: Nürnberg

Rname

  • nsc8.schlundtech.de
  • nsd8.schlundtech.de
  • nsb8.schlundtech.de
  • nsa8.schlundtech.de

Target

  • earth.klml.de

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Thu, 28 Jul 2016 18:49:42 GMT Server: Apache/2.2.15 (CentOS) Location: http://umija.org Content-Length: 302 Content-Type: text/html; charset=iso-8859-1 X-Cache: MISS from s_hp65 X-Cache-Lookup: MISS from s_hp65:80 Via: 1.1 s_hp65 (squid/3.5.19) Connection: keep-alive HTTP/1.1 200 OK Date: Thu, 28 Jul 2016 18:49:42 GMT Server: Apache X-Powered-By: PHP/5.3.29 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=f53daed5d57106c916929eef6286c800; path=/ Set-Cookie: tab_last_query=%2Ftiki-index.phpa%3A0%3A%7B%7D Set-Cookie: tab=1 Set-Cookie: runs_before_js_detect=2; expires=Fri, 28-Jul-2017 18:49:42 GMT Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_hp65 X-Cache-Lookup: MISS from s_hp65:80 Transfer-Encoding: chunked Via: 1.1 s_hp65 (squid/3.5.19) Connection: keep-alive

DNS

host: umija.de
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 95.143.172.184
host: umija.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: nsc8.schlundtech.de
host: umija.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: nsd8.schlundtech.de
host: umija.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: nsb8.schlundtech.de
host: umija.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: nsa8.schlundtech.de
host: umija.de
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: nsa8.schlundtech.de
  5. rname: earth.klml.de
  6. serial: 2013101201
  7. refresh: 39940
  8. retry: 14400
  9. expire: 604800
  10. minimum-ttl: 86400
host: umija.de
  1. class: IN
  2. ttl: 86400
  3. type: AAAA
  4. ipv6: 2001:1a50:11::5f:8f:acb8:9e

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.mija.de, www.uwmija.de, www.wmija.de, www.uemija.de, www.emija.de, www.usmija.de, www.smija.de, www.uamija.de, www.amija.de, www.uija.de, www.umpija.de, www.upija.de, www.umoija.de, www.uoija.de, www.umiija.de, www.uiija.de, www.umkija.de, www.ukija.de, www.um.ija.de, www.u.ija.de, www.umuija.de, www.uuija.de, www.umjija.de, www.ujija.de, www.umnija.de, www.unija.de, www.um-ija.de, www.u-ija.de, www.umja.de, www.umirja.de, www.umrja.de, www.umifja.de, www.umfja.de, www.umivja.de, www.umvja.de, www.umikja.de, www.umkja.de, www.umi,ja.de, www.um,ja.de, www.umibja.de, www.umbja.de, www.umigja.de, www.umgja.de, www.umitja.de, www.umtja.de, www.umiyja.de, www.umyja.de, www.umiuja.de, www.umuja.de, www.umijja.de, www.umjja.de, www.umimja.de, www.ummja.de, www.uminja.de, www.umnja.de, www.umia.de, www.umijza.de, www.umiza.de, www.umijha.de, www.umiha.de, www.umijna.de, www.umina.de, www.umij.a.de, www.umi.a.de, www.umijua.de, www.umiua.de, www.umijka.de, www.umika.de, www.umijla.de, www.umila.de, www.umijoa.de, www.umioa.de, www.umij.de, www.umijao.de, www.umijo.de, www.umijap.de, www.umijp.de, www.umija9.de, www.umij9.de, www.umija.de, www.umij.de, www.umijai.de, www.umiji.de, www.umijau.de, www.umiju.de,

Other websites we recently analyzed

  1. Serveur Minecraft 1.8 français - Minecraft-Addict.com
    Serveur minecraft 1.8 francophone le plus fun ! Tout minecraft en quelques clics! Maps survie/semi-RP/rpg , pvp/faction et creatif. Compétances RPG, sorts à collectionner, site web interactif, venez découvrir la communauté de notre serveur Minecraft 1.8 !
    France - 37.187.89.200
    Server software: Apache
    Technology: Google Adsense, CSS, Font Awesome, Html, Html5, Javascript, jQuery, jQuery UI, Php
    Number of Javascript: 5
    Number of meta tags: 4
  2. ULKUCU HACKTEAM
    Brea (United States) - 64.90.40.14
    Server software: Apache
    Technology: CSS, Google Font API, Html, Javascript, Php, SVG, Wordpress
    Number of Javascript: 1
    Number of meta tags: 4
  3. Service4Logistic
    Poland - 79.96.238.137
    Server software: IdeaWebServer/v0.80
    Technology: CSS, Html, Javascript, jQuery
    Number of Javascript: 2
    Number of meta tags: 4
  4. cnfocus
    Beijing (China) - 114.113.158.13
    Server software: Apache/2.2.8 (Win32) PHP/5.2.6
    Technology: CSS, Html, Php
    Number of Javascript: 2
    Number of meta tags: 2
  5. 拉索城堡官方网站
    拉索城堡-----世界因我而不同，官方客服电话：4006-120-289。1
    Central District (Hong Kong) - 121.127.234.105
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Javascript, jQuery
    Number of Javascript: 3
    Number of meta tags: 3
  6. iri.hs.kr
    Korea, Republic of - 211.210.30.141
    Server software:
    Technology: Javascript
  7. saltlakevalleycarpetcleaning.info
    Scottsdale (United States) - 184.168.221.42
    Server software:
    Technology: Html, Html5, Iframe
  8. Zenfolio | JL Photo & Design
    Jessica Lingenfelter Photography & Design provides graphic design work and artistic pictures and portraits with a modern and vintage flair. See our website for portfolios and pricing. Located in Neosho, MO.
    Europe - 95.100.248.121
    Server software:
    Technology: CSS, Google Font API, Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 4
  9. maplelab
    Italy - 92.223.209.197
    Server software: Microsoft-IIS/7.5
    Technology: Html, Javascript, Google Analytics
    Number of meta tags: 2
  10. Дом здоровья "Оберег"
    Дом здоровья "Оберег"
    Russian Federation - 185.42.12.3
    Server software: nginx/1.0.15
    Technology: Carousel, CSS, Html, Javascript, jQuery, Php, LiveInternet counter
    Number of Javascript: 8
    Number of meta tags: 4

Check Other Websites